PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009106115.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 280aa    MW: 32228.6 Da    PI: 6.1874
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009106115.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.66.7e-25115165252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     +k +s+e++s+yF++pi++AA eL+v+lT+LKr+CR++G +RWPhRk+ sl
  XP_009106115.1 115 SKALSMETISRYFYMPITQAAMELDVGLTLLKRRCRELGFRRWPHRKLMSL 165
                     689*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.608100185IPR003035RWP-RK domain
PfamPF020427.4E-20118165IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MVDHKLKEDK PFSFLTYSPS FDDHIALTFP SFDWEEELLP LHNNFVSQAF HLPTPSLSLP  60
DLEPLSQDVL DSYSSAEQNR GEDDLDMNTK KRRLNREHNV RIISDVTTYT TFPASKALSM  120
ETISRYFYMP ITQAAMELDV GLTLLKRRCR ELGFRRWPHR KLMSLLALIS NVKERQKMQG  180
GEKAGIFKNA VEILEDERRR IEENPDLEFS DKTKRLRQAC FKATHKMKKK NSLKSSEMSK  240
PSCSSSGSVL SEEESVIEGV ESDEEVKYLL CGFTNEFSGL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00234DAPTransfer from AT1G74480Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895741e-162AC189574.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH011B08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106115.10.0PREDICTED: protein RKD2
RefseqXP_013649774.10.0PREDICTED: protein RKD2-like
RefseqXP_013701812.10.0PREDICTED: protein RKD2-like
SwissprotQ9CA661e-113RKD2_ARATH; Protein RKD2
TrEMBLA0A078E7890.0A0A078E789_BRANA; BnaA07g31600D protein
TrEMBLM4DHD00.0M4DHD0_BRARP; Uncharacterized protein
STRINGBra015907.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39662356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.13e-89RWP-RK domain-containing protein